This is a working overview of Hepatocyte growth factor, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-05-18. Anything still debated is marked as such rather than presented as settled.
Reported effects of dihexa are often described in terms of synaptogenesis, a process by which neurons form new synaptic connections. This concept is biologically plausible but difficult to measure directly in living humans. Animal behavioral tests can suggest memory or learning changes, yet such tests have limitations and may not translate to people. The literature includes conflicting or incomplete findings, and some studies are small. As a result, the mechanism remains a subject of investigation rather than a settled explanation.
The proposed mechanism of dihexa involves activation of hepatocyte growth factor and its receptor, c-Met. In cell models, this signaling pathway is associated with dendritic spine formation and synaptic reorganization. Dihexa is described as a stabilized analog of angiotensin IV, which also interacts with related systems. However, the precise binding profile and downstream effects remain incompletely characterized. Most mechanistic evidence comes from in vitro assays and rodent studies rather than human trials.
Dihexa is not approved for human use in the United States or the European Union. It is commonly sold as a research chemical, a category that may not require the same regulatory review as medicines. Buyers should note that product labels may lack independent verification of identity or purity. The legal status can vary by country, and importation may be restricted. Reliable information about sourcing and quality is often scarce. Scientific publications typically use synthesized material from laboratories rather than commercial consumer products.
Dihexa is a synthetic peptide studied in laboratory research. It is often described as an angiotensin IV analog or a hepatocyte growth factor mimetic. The compound emerged from investigations into angiotensin IV and its effects on neural pathways. It is not an approved medication, and controlled human trials are lacking. In literature and online forums, it is discussed mainly as a research chemical. Its chemical name appears as N-hexanoic-Tyr-Ile-(6-aminohexanoic amide) in some sources.
| Property | Value | Notes |
|---|---|---|
| Primary reported target | Hepatocyte growth factor/c-Met signaling | Findings mainly from cell and animal studies. |
| Related endogenous peptide | Angiotensin IV | Dihexa is described as a stabilized analog. |
| Common analytical method | Reverse-phase high-performance liquid chromatography | Used for purity assessment. |
| Identity confirmation | Mass spectrometry | Provides a molecular mass check. |
| Regulatory status | Not approved for human use | Sold as a research chemical in many jurisdictions. |
Analytical confirmation generally combines a separation method with a detection method. Reverse-phase high-performance liquid chromatography can assess purity, while mass spectrometry supports molecular identity. For research-grade material, a certificate of analysis may report a batch-specific purity value, but it does not guarantee biological activity or safety. Regulatory frameworks vary by country; many jurisdictions treat dihexa as a research chemical not intended for human consumption. Purchasers should verify local rules and supplier documentation. The absence of official standards makes independent testing and careful record-keeping important for laboratory work.
In laboratory settings, dihexa is typically handled as a research chemical rather than a pharmaceutical product. Suppliers may provide it as a lyophilized powder or in solution, and purity is often stated as a percentage determined by chromatographic analysis. Because independent verification is uncommon, researchers generally rely on certificates of analysis, which may include high-performance liquid chromatography and mass spectrometry data. The absence of pharmacopeial monographs means that identity, purity, and impurity profiles can vary between batches and suppliers.
Storage recommendations for peptides and peptide-like compounds usually emphasize low temperatures, desiccation, and protection from light. A common practice is to keep dry powder at -20 °C or below and to prepare solutions shortly before use. Repeated freeze-thaw cycles may degrade the material, so aliquoting is often advised. Solubility depends on the solvent; aqueous solubility may be limited, and organic solvents such as dimethyl sulfoxide are sometimes used for stock solutions. Stability data specific to dihexa are sparse, so general peptide handling guidelines are often applied instead.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
The proposed mechanism involves interaction with the hepatocyte growth factor (HGF) system and its receptor, c-Met. Dihexa is described in some studies as an HGF mimetic, meaning it may mimic or enhance HGF-mediated signaling. Activation of c-Met can influence cell growth, survival, and cytoskeletal remodeling, pathways that intersect with synaptic plasticity. However, the precise binding targets and downstream events for dihexa are not fully established, and alternative mechanisms have been suggested.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Dihexa appears in scientific literature, patent documents, and commercial catalogs under several names, which can complicate searching and verification. The compound is frequently grouped with nootropics or research chemicals, terms that describe context of use rather than regulatory approval. Such labeling may imply benefits that have not been confirmed in controlled human studies. Readers encountering promotional descriptions should distinguish between preclinical observations and established medical facts. The absence of regulatory approval is a central feature of its current status.
Dihexa is a synthetic peptide-like compound studied in preclinical research for its reported effects on synaptic growth and cognitive measures in animal models. It is often described as an analog of angiotensin IV, a naturally occurring peptide fragment. The compound has not been approved as a medicine in any major jurisdiction. Most public information comes from laboratory studies, patents, and online vendor listings rather than from large clinical trials. Its scientific status therefore differs from that of an established pharmaceutical.
Animal studies have examined dihexa in models of cognitive impairment, synaptic plasticity, and memory. Some reports describe improved performance on maze or avoidance tasks after administration. These findings are preclinical and often involve small samples, varied routes, and differing formulations. Results in rodents do not establish effects in humans. The absence of published randomized controlled trials in people is a major gap in the evidence base. Observational reports and user accounts do not substitute for controlled clinical data.
Discussion in the literature often separates direct receptor activation from downstream growth-factor modulation. Dihexa is not simply an angiotensin receptor blocker or a classic nootropic drug. Its proposed action may depend on endogenous HGF levels, which vary by tissue and physiological state. Questions remain about brain penetration, metabolic stability, and active metabolites. Reviews note that mechanistic claims should be treated as hypotheses until supported by independent studies. That distinction is important when interpreting promotional claims or early laboratory findings.
Agonists PACAP-38 (endogenous peptide agonist, full length version) - also activates other receptors VIP, GPR55 and MRGPRX2 and the Secretin receptor. PACAP-27 (endogenous peptide agonist, shorter fragment which retains activity) Antagonists PACAP(6-38) - N-terminal truncated version of the endogenous peptide agonist which acts as a potent PAC1 antagonist BAY 2686013 PA-915 "VIP and PACAP Receptors: PAC1". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. Human ADCYAP1R1 genome location and ADCYAP1R1 gene details page in the UCSC Genome Browser. This article incorporates text from the United States National Library of Medicine, which is in the public domain.
Antimicrobial peptides are produced by species across the tree of life, including: bacteria (e.g. bacteriocin, and many others) fungi (e.g. peptaibols, plectasin, and many others) cnidaria (e.g. hydramacin, aurelin) many from insects and arthropods (e.g. cecropin, attacin, melittin, mastoparan, drosomycin, thioester-containing protein 1) amphibia, frogs (magainin, dermaseptin, aurein, and others) birds (e.g. avian defensins) and mammals (e.g. cathelicidins, alpha- and beta-defensins, regIII peptides) Research has increased in recent years to develop artificially-engineered mimics of antimicrobial peptides such as SNAPPs, in part due to the prohibitive cost of producing naturally-derived AMPs. An example of this is the facially cationic peptide C18G, which was designed from the C-terminal domain of human platelet factor IV. Currently, the most widely used antimicrobial peptide is nisin; being the only FDA approved antimicrobial peptide, it is commonly used as an artificial preservative.
Automated synthesis or automatic synthesis is a set of techniques that use robotic equipment to perform chemical synthesis using a robotic system run using software control. Automating processes allows for higher efficiency and product quality although automation technology can be cost-prohibitive and there are concerns regarding overdependence and job displacement. Chemical processes were automated throughout the 19th and 20th centuries, with major developments happening in the previous thirty years, as technology advanced. Tasks that are performed may include: synthesis in variety of different conditions, sample preparation, purification, and extractions. Applications of automated synthesis are found on research and industrial scales in a wide variety of fields including polymers, personal care, and radiosynthesis.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Acromegaly is a disorder that results in excess growth of certain parts of the human body. It is caused by excess growth hormone (GH) after the growth plates have closed. The initial symptom is typically enlargement of the hands and feet. There may also be an enlargement of the forehead, jaw, and nose. Other symptoms may include joint pain, thickened skin, deepening of the voice, headaches, and problems with vision. Complications of the disease may include type 2 diabetes, sleep apnea, and high blood pressure. Features that may result from a high level of GH or expanding tumor include:
Sources: en.wikipedia.org
The permeability of a membrane is the rate of passive diffusion of molecules through the membrane. These molecules are known as permeant molecules. Permeability depends mainly on the electric charge and polarity of the molecule and to a lesser extent the molar mass of the molecule. Due to the cell membrane's hydrophobic nature, small electrically neutral molecules pass through the membrane more easily than charged, large ones. The inability of charged molecules to pass through the cell membrane results in pH partition of substances throughout the fluid compartments of the body. Lipids, Membranes and Vesicle Trafficking – The Virtual Library of Biochemistry and Cell Biology Cell membrane protein extraction protocol Membrane homeostasis, tension regulation, mechanosensitive membrane exchange and membrane traffic 3D structures of proteins associated with plasma membrane of eukaryotic cells Lipid composition and proteins of some eukariotic membranes Prokaryotic and Eukaryotic Cells
SNX8 contains a PX domain in its N-terminus, which is located between amino acids 71 and 181. A homology domain with yeast's PX domain is localized between amino acids 75 and 178 within this same domain. As it is a phosphoinositide-binding domain, it is important to highlight amino acids 109, 135 and 148 as residues directly related to phosphatidylinositol 3-phosphate since being specific binding sites, constituting a phosphoinositid binding site with a span of 40 amino acids. Furthermore, it includes a pair of phosphorylable tyrosines in positions 95 and 126 that are key in its function in the IFNγ-triggered IKKβ-mediated noncanonical signaling pathway. Overall, the PX domain main function is to target SNX8 mainly to early endosomes and other membranes rich in phosphatidylinositol 3-phosphate phospholipids.
Glutathione plays a central role in cellular redox balance, detoxification, and immune regulation. Its synthesis depends on the availability of several amino acid substrates, of which cysteine is typically the rate-limiting precursor under physiological conditions. Free L-cysteine is chemically unstable and readily oxidized in the gastrointestinal tract, which can limit its effectiveness when administered directly as a supplement. For this reason, a variety of cysteine-delivery strategies have been explored, including N-acetylcysteine (NAC) and other cysteine prodrugs. D-Ribose-L-cysteine was developed as an alternative cysteine-delivery compound intended to improve cysteine stability and intracellular availability for glutathione synthesis.
The kappa and lambda light chains undergo rearrangements of the V and J gene segments. In this process, a functional Vlambda can combine with four functional Jλ –Cλ combinations. On the other hands, Vk gene segments can join with either one of the Jk functional gene segments. The overall rearrangements result in a gene segment order from 5 prime to 3 prime end. These are a short leader (L) exon, a noncoding sequence (intron), a joined VJ segment, a second intron, and the constant region. There is a promoter upstream from each leader gene segment. The leader exon is important in the transcription of light chain by the RNA polymerase. This sequence is translated to guide the polypeptide to the internal environment of the endoplasmic reticulum, but is cleaved and absent from the mature protein. To remain with coding sequence only, the introns are removed during RNA- processing and repairing.
APHL supports the role of the public health laboratory in disease detection and surveillance, and works to expand and enhance relationships among member laboratories, by coordinating with the CDC, other federal and state agencies, associations and academia involved in relevant public health activities, including laboratory testing, policy and training. As of December 2021 the director of this group was Kelly Wroblewski. APHL's infectious disease programs focuses on continuous monitoring on spread of the following infectious diseases including: Arboviruses, including West Nile, Dengue, Chikungunya and Zika viruses Coronavirus (COVID-19) Ebola HIV Influenza Rabies Sexually transmitted diseases including Chlamydia, Gonorrhea, Herpes Simplex Virus, HPV, Syphilis and Trichomoniasis Tuberculosis Vaccine preventable diseases, including measles, mumps and rubella (MMR vaccines) and diphtheria, tetanus and pertussis (DTP) Viral Hepatitis
Sources: en.wikipedia.org
Dihexa has been reported to activate hepatocyte growth factor/c-Met signaling in cell studies. This pathway is linked to synapse formation and neuronal remodeling. The exact molecular interactions are not fully understood.
Reverse-phase high-performance liquid chromatography is commonly used to assess purity. Mass spectrometry is used to confirm molecular identity. These methods are typical for synthetic peptides and research chemicals.
Dihexa is not approved as a drug in major jurisdictions. It is often sold as a research chemical, which is not the same as a medicine. Its legal status can vary by country and may change.
Dihexa is a synthetic peptide investigated in preclinical research. It is often classified as an angiotensin IV analog or an HGF mimetic. It is not an approved medicine.